PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G314400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MIKC_MADS
Protein Properties Length: 227aa    MW: 25930.7 Da    PI: 10.0869
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G314400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.54.9e-30959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          krien + rqvtfskRrng+lKKA+ELSvLCdaev +i+fs++gklye++s
  Sobic.001G314400.1.p  9 KRIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVGLIVFSPRGKLYEFAS 59
                          79***********************************************86 PP

2K-box66.96.7e-2378171598
                 K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                            ++++ +++ ++ + ++  L +++e L++++R++lGe+Le++s++eL++Le +L ksl  iR kK++ll +qi +l++ke++l ++nk+
  Sobic.001G314400.1.p  78 VNNKTVQQDIQQVKADAVSLANRLEALEKTKRKFLGENLEECSIEELHNLEVKLAKSLHVIRGKKTQLLEQQITKLKEKERNLLKDNKE 166
                           4455778899******************************************************************************* PP

                 K-box  94 Lrkkl 98 
                           Lr k 
  Sobic.001G314400.1.p 167 LRDKQ 171
                           **985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.1E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.805161IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.33E-32385IPR002100Transcription factor, MADS-box
CDDcd002651.95E-41374No hitNo description
PRINTSPR004041.7E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.1E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-313859IPR002100Transcription factor, MADS-box
PfamPF014862.2E-2384170IPR002487Transcription factor, K-box
PROSITE profilePS5129713.51987177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010048Biological Processvernalization response
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MVRGKTELKR IENATSRQVT FSKRRNGLLK KAYELSVLCD AEVGLIVFSP RGKLYEFASA  60
ASLQKTIDRY RTYTRENVNN KTVQQDIQQV KADAVSLANR LEALEKTKRK FLGENLEECS  120
IEELHNLEVK LAKSLHVIRG KKTQLLEQQI TKLKEKERNL LKDNKELRDK QRNLQPPPEA  180
PPVLNRCLPP WPRNLPAPPS NDDMDVETEL YIGLPGRERS SNRDSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J3e-17373271Myocyte-specific enhancer factor 2A
3p57_I3e-17373271Myocyte-specific enhancer factor 2A
3p57_D3e-17373271Myocyte-specific enhancer factor 2A
3p57_C3e-17373271Myocyte-specific enhancer factor 2A
3p57_B3e-17373271Myocyte-specific enhancer factor 2A
3p57_A3e-17373271Myocyte-specific enhancer factor 2A
3kov_J3e-17373271Myocyte-specific enhancer factor 2A
3kov_I3e-17373271Myocyte-specific enhancer factor 2A
3kov_B3e-17373271Myocyte-specific enhancer factor 2A
3kov_A3e-17373271Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.83760.0leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0648230.0BT064823.1 Zea mays full-length cDNA clone ZM_BFb0180I10 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001168784.11e-152uncharacterized protein LOC100382583
SwissprotA2Z9Q71e-110MAD56_ORYSI; MADS-box transcription factor 56
TrEMBLC0P9541e-152C0P954_MAIZE; MADS transcription factor
STRINGSb01g030570.11e-164(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.11e-67AGAMOUS-like 19